CRS1C-4 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CRS1C-4 (Fragment)
  • GlycoProtDB: GPDB0001976
  • UniProt ID: B3VKY3
  • Gene Symbol: Defa29
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 47 22823882

Sequence

LQDAAQRRFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0