Cd84 protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cd84 protein
  • GlycoProtDB: GPDB0001999
  • UniProt ID: B7ZMQ1
  • Gene Symbol: Cd84
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 143 17406563
22823882
23002422
2 144 23002422
3 147 17406563
22823882
23002422
4 198 23002422

Sequence

MAQRHLWIWFLCLQTWSEAAGKDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAVLPGGLAVLFLLILIPMLAFLFRLYKRRRDRIVLEDDVSKKTVYAVVSRNAQPTESRIYDEIPQSKMLSCKKDPVTTIYSSVQLSEKMKETNMKDRSLPKALGNEIVV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0