Cfd protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cfd protein
  • GlycoProtDB: GPDB0002030
  • UniProt ID: B7ZNS9
  • Gene Symbol: Cfd
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 123 17406563
22823882
23002422
2 175 22823882
3 250 17406563
22823882
23002422
4 255 17406563
22823882
23002422

Sequence

MHSSVYFVALVILGAAVCAQPRGRILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0