ASL1/Antrx2 fusion protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
ASL1/Antrx2 fusion protein
  • GlycoProtDB: GPDB0002075
  • UniProt ID: C6EQH0
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 50 23002422

Sequence

MMILAQSCTEILELSPSSVCVGEKFQVVLTGRAVTSISHDGSVLCTFTANSTYTKSEKPVSIQPSSILCPAPVLNKDGETLEVSISYNDGKSAVSRSLTITATECTNGIAAIVAILVLLLLLGAALMWWFWPLCCKVVIKDPPPPPSAPMEEEEEDPLPNKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVMVPEEEIPIPSRPPRPRPTHQAPQTKWYTPIKGRLDALWALIMKQYDRVSLMRPQEGDEGRCINFSRVPHQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0