Cell cycle control protein 50A

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell cycle control protein 50A
  • GlycoProtDB: GPDB0002113
  • UniProt ID: D3YVV1
  • Gene Symbol: Tmem30a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 144 22823882
23002422
2 154 22823882
23002422
3 261 23002422

Sequence

MAMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTADITI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0