CSC1-like protein 2 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CSC1-like protein 2 (Fragment)
  • GlycoProtDB: GPDB0002155
  • UniProt ID: D3YYJ8
  • Gene Symbol: Tmem63b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 15 17406563
22823882
23002422

Sequence

MLPFLLATLGTAALNSSNPKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFLALLFLFSILRKVAWDYGRLALVTDADRLRRQERERVEQEYVASAMHGDSHDRYERLTSVSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSGDLLENNAYSFGRTTIANLKS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0