Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C (Fragment)
  • GlycoProtDB: GPDB0002165
  • UniProt ID: D3YZM8
  • Gene Symbol: Mgat4c
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 78 22823882
2 84 22823882

Sequence

MLKFYQMKYIFQILDKMRCLRKRSTVSFLGVLVVFLLFMNLYIEDSYVLEGDKQLIRETSTHQLNSERYVHTFKDLSNFSGTINVTYRYLAATPLQRKRYLTIGLSSVKRKKGNYLLDTIKSIFEQSSYEELKEISVVVHLADFNSSWRD

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0