60 kDa heat shock protein, mitochondrial (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
60 kDa heat shock protein, mitochondrial (Fragment)
  • GlycoProtDB: GPDB0002196
  • UniProt ID: D3Z2F2
  • Gene Symbol: Hspd1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 103 22823882

Sequence

MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0