CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2

Entry of glycoprotein extracted from GlycoProtDB


Summary
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
  • GlycoProtDB: GPDB0002211
  • UniProt ID: D3Z3V2
  • Gene Symbol: St3gal2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 211 17406563
22823882
23002422

Sequence

MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYSGLQRLGKEGLLGRNCACSRCMGDASTSEWFDSHFDGNISPVWTRDNMNLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVGSRCCLEQN

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0