All-trans retinoic acid-induced differentiation factor

Entry of glycoprotein extracted from GlycoProtDB


Summary
All-trans retinoic acid-induced differentiation factor
  • GlycoProtDB: GPDB0002255
  • UniProt ID: D3Z6U7
  • Gene Symbol: Atraid
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 20 22823882
23002422
2 80 22823882
3 98 22823882
4 109 22823882

Sequence

MQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0