CSC1-like protein 1

Entry of glycoprotein extracted from GlycoProtDB


Summary
CSC1-like protein 1
  • GlycoProtDB: GPDB0002307
  • UniProt ID: E0CXH8
  • Gene Symbol: Tmem63a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 28 22823882
23002422

Sequence

MTSSPFLDPWPSKAVFVRERLGLGERPNDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVSCFL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0