Cell adhesion molecule 1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell adhesion molecule 1
  • GlycoProtDB: GPDB0002316
  • UniProt ID: E0CY16
  • Gene Symbol: Cadm1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 70 17406563
22823882
2 104 17406563
22823882
23002422
3 116 17406563
22823882
23002422
4 168 22823882
5 307 17406563
22823882
23002422
6 311 17406563
22823882

Sequence

MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGLFSLTSSPRIK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0