Alkylglycerol monooxygenase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alkylglycerol monooxygenase
  • GlycoProtDB: GPDB0002323
  • UniProt ID: E0CYN0
  • Gene Symbol: Agmo
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 9 17406563
22823882

Sequence

MRSPGAQDNVSVSQGMRAMFYMMEPSETAFQTVEEVPDYVKKATPFFIFLILLELVISWILKGKPSGRLDDALTSISAGVVSRLPRFLLEIKLCSRQISTNISLGIRYFSMYNI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0