CD36 antigen variant (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD36 antigen variant (Fragment)
  • GlycoProtDB: GPDB0002340
  • UniProt ID: E7D893
  • Gene Symbol: Cd36
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 95 22823882

Sequence

SSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGLHPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEKAEMFKTQVTGKIKLLGMVEMALLGIGVVM

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0