Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
  • GlycoProtDB: GPDB0002346
  • UniProt ID: E9PUI0
  • Gene Symbol: St6galnac6
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 64 22823882
23002422
2 72 22823882
3 115 22823882
23002422
4 139 22823882

Sequence

MSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNKTLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0