Antigen-presenting glycoprotein CD1d1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Antigen-presenting glycoprotein CD1d1
  • GlycoProtDB: GPDB0002483
  • UniProt ID: E9Q395
  • Gene Symbol: Cd1d1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 38 17406563
22823882
23002422

Sequence

MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0