Chemokine-like receptor 1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Chemokine-like receptor 1 (Fragment)
  • GlycoProtDB: GPDB0002572
  • UniProt ID: E9Q8N2
  • Gene Symbol: Cmklr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 190 17406563
22823882
23002422

Sequence

MEYDAYNDSGIYDDEYSDGFGYFVDLEEASPWEAKVAPVFLVVIYSLVCFLGLLGNGLVIVIATFKMKKTVNTVWFVNLAVADFLFNIFLPMHITYAAMDYHWVFGKAMCKISNFLLSHNMYTSVFLLTVISFDRCISVLLPVWSQNHRSIRLAYMTCSAVWVLAFFLSSPSLVFRDTANIHGKITCFNNFSLAAPESSPHPAHSQVVSTGYSRHVAVTVTRFLCGFLIPVFIITACYLTIVFKLQRNRLAKNKKPFKIIITIIITFFLCWCPYHTLYLLELHHTAVPSSVFSLGLPLATA

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0