Advanced glycosylation end product-specific receptor variant 2

Entry of glycoprotein extracted from GlycoProtDB


Summary
Advanced glycosylation end product-specific receptor variant 2
  • GlycoProtDB: GPDB0002645
  • UniProt ID: F1ABR8
  • Gene Symbol: Ager
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 80 22823882

Sequence

MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEDGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLLSASGSQKPAMRGQLKALWVSLGWVR

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0