C4b-binding protein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
C4b-binding protein (Fragment)
  • GlycoProtDB: GPDB0002666
  • UniProt ID: F6QLW4
  • Gene Symbol: C4bp
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 62 17406563
22823882
23002422
2 110 17406563
22823882
23002422
3 188 22823882
23002422

Sequence

XVAWSNPFPECVIVKCGPPPDISNGKHSGTEDFYPYNHGISYTCDPGFRLVGSPFIGCTVVNKTVPVWSSSPPTCEKIICSQPNILHGVIVSGYKATYTHRDSVRLACLNGTVLRGRHVIECQDCDLPPAIVNGYYTSMVYSKITLVTYECDKGYRLVGKAIISCSFSKWKGTAPQCKALCQKPEVGNGTLSDEKDQYV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0