All-trans retinoic acid-induced differentiation factor (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
All-trans retinoic acid-induced differentiation factor (Fragment)
  • GlycoProtDB: GPDB0002684
  • UniProt ID: F6RYG0
  • Gene Symbol: Atraid
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 23 ---
2 57 22823882
23002422
3 117 22823882
4 135 22823882
5 146 22823882

Sequence

XLGVERALALPEICTLCPGGMHNLSRVAAYCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQPSPFYFGEPS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0