Carbonic anhydrase 4 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carbonic anhydrase 4 (Fragment)
  • GlycoProtDB: GPDB0002694
  • UniProt ID: F6ST32
  • Gene Symbol: Car4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 73 17406563
22823882

Sequence

XMHIVHKKLTSSKEDSKDKFAVLAFMIEVGDKVNKGFQPLVEALPSISKPLRESSLQDMLPPSTKMYTYFRYNGSLTTPNCDETVIWTVYKQPIKIHKNQFLEFSKNLYYDEDQKLNMKDNVRPLQPLGKRQVFKSHAPGQLLSLPLPTLLVPTLTCLVANFLQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0