Alpha-2-macroglobulin receptor-associated protein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-2-macroglobulin receptor-associated protein (Fragment)
  • GlycoProtDB: GPDB0002732
  • UniProt ID: F6WMD1
  • Gene Symbol: Lrpap1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 64 17406563
22823882

Sequence

XELHSDLKIQERDELNWKKLKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0