Cell surface glycoprotein MUC18 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell surface glycoprotein MUC18 (Fragment)
  • GlycoProtDB: GPDB0002768
  • UniProt ID: F7ATH5
  • Gene Symbol: Mcam
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 27 17406563
22823882
23002422

Sequence

VPTPDLVEAEVGSTALLKCGPSRASGNFSQVDWFLIHKERQILIFRVHQGKGQREPGEYEHRLSLQDSVATLALSHVTPHDERMFLWSCGPCSKDGSPCPCSFPFHCRSPRGTNYSSQCRGHPCGQARAQGGCYLCGEKRLPHSSSPMV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0