Alkaline phosphatase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alkaline phosphatase
  • GlycoProtDB: GPDB0002795
  • UniProt ID: F8VPQ6
  • Gene Symbol: Alpi
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 428 22823882

Sequence

MQGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNAAGQATTTNNAAGQATVLLSLQLLVSMLLLVGTAMVVS

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0