Cell adhesion molecule 2 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell adhesion molecule 2 (Fragment)
  • GlycoProtDB: GPDB0002870
  • UniProt ID: G3UZM4
  • Gene Symbol: Cadm2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 31 17406563
22823882
2 51 17406563
22823882
3 211 17406563
22823882
4 287 17406563
22823882
5 291 17406563
22823882

Sequence

FFFLCNLSLVPAAASKSKVKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQALTLTCESKGKPLPEPVLWTKDGAELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTAPVTTSVTITTSPSTSASSSSRRDPNSLAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0