Apolipoprotein N, isoform CRA_a

Entry of glycoprotein extracted from GlycoProtDB


Summary
Apolipoprotein N, isoform CRA_a
  • GlycoProtDB: GPDB0002897
  • UniProt ID: G3X9D6
  • Gene Symbol: Apon
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 25 17406563
22823882
23002422
2 187 17406563
22823882

Sequence

MIQAALLLGCILLSPVTAFPWKTQNGSLPAVTRTEPTSNVLPNKIPPPTPITCRDLLYTVLPAAPLSEFLSLLALRVVLENIGCPAEAYSLQLRISEMGGKDSAETLVLQSQKSSQEEGIGNNEVILRHLVPSPGDMRRVRRSVTLPEACTYEPGWVLYDMAQVLLETANKLPPIDLVREFKASVVNVTQHCTMESWESMNEVARRLMSSPELKDAKIPVEDRVYLVAQLAVVLKRIFVNLVWEYFQTYFG

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0