ATPase, Na+/K+ transporting, beta 2 polypeptide (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
ATPase, Na+/K+ transporting, beta 2 polypeptide (Fragment)
  • GlycoProtDB: GPDB0002985
  • UniProt ID: I7HIF3
  • Gene Symbol: Atp1b2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 23 17406563
22823882
23002422
2 27 17406563
22823882
23002422
3 66 17406563
22823882
4 84 17406563
22823882
23002422
5 96 17406563
22823882

Sequence

YSTGQPCVFIKMNRVINFYAGANQSMNVTCVGKRPQHYRDKGRLIPKDGRDEDAENLGHFVMFPANGSIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0