ABPBG20

Entry of glycoprotein extracted from GlycoProtDB


Summary
ABPBG20
  • GlycoProtDB: GPDB0002991
  • UniProt ID: J3QK77
  • Gene Symbol: Scgb2b20
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 50 22823882

Sequence

MKGTLLLLGLLVTGELSFQTTEACLPFFEGYASVLSGSRVWLYQELQAFNATAEEKVALEKIQDCYSEERIRNILLEPKIMEAMVASPECLSYYGLDNIRSILDYISKLLGE

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0