Asialoglycoprotein receptor 2 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Asialoglycoprotein receptor 2 (Fragment)
  • GlycoProtDB: GPDB0002994
  • UniProt ID: J3QMY0
  • Gene Symbol: Asgr2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 62 23002422

Sequence

MEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0