Asialoglycoprotein receptor 1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Asialoglycoprotein receptor 1 (Fragment)
  • GlycoProtDB: GPDB0003003
  • UniProt ID: J3QPT6
  • Gene Symbol: Asgr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 46 17406563
22823882
23002422

Sequence

MKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0