Loading...

Alpha-1,4-N-acetylhexosaminyltransferase

Entry of glycoprotein extracted from GlycoProtDB



Glycosylation Sites

# Position PubMed ID
1 74 17406563
22823882

Sequence

MRGCHICKLPGRVMGIRVLRFSLVVILVLLLVAGALTNLLPNIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIVGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM

Feature



Copyright © GlyCosmos Portal v1.3.0

Last updated: April 1, 2020