Basigin

Entry of glycoprotein extracted from GlycoProtDB


Summary
Basigin
  • GlycoProtDB: GPDB0003014
  • UniProt ID: K3W4Q8
  • Gene Symbol: Bsg
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 99 22823882
23002422
2 135 22823882
23002422

Sequence

MRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0