Cellular repressor of E1A-stimulated genes 1, isoform CRA_a

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cellular repressor of E1A-stimulated genes 1, isoform CRA_a
  • GlycoProtDB: GPDB0003017
  • UniProt ID: K4DI63
  • Gene Symbol: Creg1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 34 17406563
22823882
2 90 22823882

Sequence

MSLAQTVYCRNHGFDPQSPLCVHIMMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVLDYFGGPKVVTPEEYFNVTLQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0