CAS1 domain-containing protein 1

Entry of glycoprotein extracted from GlycoProtDB


Summary
CAS1 domain-containing protein 1
  • GlycoProtDB: GPDB0003028
  • UniProt ID: M0QWG8
  • Gene Symbol: Casd1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 141 22823882
2 175 22823882
23002422
3 187 22823882

Sequence

MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEYLLSSGRFLGEKVWQPHSCMMHKYKISEAKTCLVDKHIAFIGDSRIRQLFYSFVKIINPQFKEEGNKHENIPFEDKAASVKVDFLWHPEVNGSMKQCIKVWTEDSVLKPHVIVAGAATWSIKIHNGSEEALAQYKMNITSIAPLLEKLAKTSDVYWVLQECNDSHERVLQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0