Cell surface glycoprotein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell surface glycoprotein (Fragment)
  • GlycoProtDB: GPDB0003076
  • UniProt ID: O19453
  • Gene Symbol: L(w16)
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 73 17406563
22823882
23002422

Sequence

SPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDCKA

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0