CD83 antigen

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD83 antigen
  • GlycoProtDB: GPDB0003203
  • UniProt ID: O88324
  • Gene Symbol: Cd83
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 87 23002422

Sequence

MSQGLQLLFLGCACSLAPAMAMREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0