Loading...

Cathepsin L1

Entry of glycoprotein extracted from GlycoProtDB



Glycosylation Sites

# Position PubMed ID
1 221 17406563
22823882
2 268 17406563
22823882

Sequence

MNLLLLLAVLCLGTALATPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVN

Feature


Pathway

Associated pathways from Reactome


GlyGen

Details for protein P06797-1


PDB Images



Copyright © GlyCosmos Portal v1.3.1

Last updated: May 1, 2020