Cathepsin L1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cathepsin L1
  • GlycoProtDB: GPDB0003293
  • UniProt ID: P06797
  • Gene Symbol: Ctsl
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 221 17406563
22823882
2 268 17406563
22823882

Sequence

MNLLLLLAVLCLGTALATPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVN

Feature


PDB Images


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0