Alpha-1-acid glycoprotein 2

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1-acid glycoprotein 2
  • GlycoProtDB: GPDB0003304
  • UniProt ID: P07361
  • Gene Symbol: Orm2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 69 22823882
23002422
2 76 22823882
23002422
3 94 22823882
23002422
4 104 22823882
23002422

Sequence

MALHMILVMVSLLPLLEAQNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0