Antigen-presenting glycoprotein CD1d2

Entry of glycoprotein extracted from GlycoProtDB


Summary
Antigen-presenting glycoprotein CD1d2
  • GlycoProtDB: GPDB0003353
  • UniProt ID: P11610
  • Gene Symbol: Cd1d2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 60 17406563
22823882
23002422

Sequence

MRYLPCLLLWAFLQVWGQSEVQQKNYTFRCLQTSSFANISWSRTDSLILLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSTGCEMYPGNASESFFHVAFQGKYAVRFRGTSWQRVLGAPSWLDLPIKVLNADQGTSATVQTLLNDTWPQFARGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHLQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR

Feature


PDB Images




Copyright © 2019    GlyCosmos Portal v1.2.0