Basigin

Entry of glycoprotein extracted from GlycoProtDB


Summary
Basigin
  • GlycoProtDB: GPDB0003454
  • UniProt ID: P18572
  • Gene Symbol: Bsg
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 160 17406563
22823882
23002422
2 270 22823882
23002422
3 306 22823882
23002422

Sequence

MAAALLLALAFTLLSGQGACAAAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0