Alpha-2-HS-glycoprotein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-2-HS-glycoprotein
  • GlycoProtDB: GPDB0003548
  • UniProt ID: P29699
  • Gene Symbol: Ahsg
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 99 17406563
22823882
2 156 17406563
22823882
23002422
3 176 17406563
22823882
23002422

Sequence

MKSLVLLLCFAQLWGCQSAPQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKI

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0