CD81 antigen

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD81 antigen
  • GlycoProtDB: GPDB0003590
  • UniProt ID: P35762
  • Gene Symbol: Cd81
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 155 22823882
23002422

Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGNKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

Feature


PDB Images


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0