Biliary glycoprotein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Biliary glycoprotein (Fragment)
  • GlycoProtDB: GPDB0003877
  • UniProt ID: Q03679
  • Gene Symbol: Ceacam1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 42 ---
2 52 ---
3 123 17406563
22823882
23002422

Sequence

PGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDPTQGGLSDGAIAGIVIGAVAGVALIAGLAYFLYSRKSGGSGSF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0