Alkaline phosphatase (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alkaline phosphatase (Fragment)
  • GlycoProtDB: GPDB0003969
  • UniProt ID: Q0VD75
  • Gene Symbol: Alpi
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 427 22823882

Sequence

QGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAVKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNAAGQATTTNNAAGQATVLLSLQLLVSMLLLVGTAMVVS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0