C-type lectin domain family 12 member B

Entry of glycoprotein extracted from GlycoProtDB


Summary
C-type lectin domain family 12 member B
  • GlycoProtDB: GPDB0004002
  • UniProt ID: Q149M0
  • Gene Symbol: Clec12b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 91 22823882
2 97 22823882

Sequence

MSDEVTYATLMLQDSARVRGNQDGNNLRKEGHPAQSSLWRGAALSLMTLCLVLVTGLVTLATMFLQVSNDINSDSEKLSQLQKSIHPQQDNLSESLNSSRKSLTEESLQSQISALLERQEQMATKLCKEFLIHASDHKCNPCPKTWQWYGNSCYYFSINEEKSWSDSRKDCIDKNATLVKIDSTEERDLLQSQLSLTFSFFWLGLSWNSSGRNWLWEDGSFPPPTLFSDKELASFNGSRDCAYFERGNIYASRCSAEIPWICEKTASLVKTEDLD

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0