CAR-like soluble protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
CAR-like soluble protein
  • GlycoProtDB: GPDB0004044
  • UniProt ID: Q1RME4
  • Gene Symbol: Gm1123
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 93 22823882
2 232 22823882
3 357 22823882

Sequence

MVFLLGFLFLCGVTDHIGSVSITTPEQTIQEVQGETVHLPCMFTLSPEDQGPLDIEWLRLSGPNNEAMDHVIILYAVDKIYSDFYQDMRGRVNFTSNGITSGEASIKIRDVQPADSGTYLCKVKTAPGVAKTTVQLTVVDYIGSVSITTPEQTIEKDQGETVHLPCMFTFISKDQGPLNIEWLRLSGPNNEAMDHVVILYSADKIHDDVYPDLKGRVYFTSNDIKSGDASINITNVQLSDAGTYQCKVKTYPGTVNRNLQLAVTDHIGSVSITTPEQTIQKARGETVHLPCTFTLSPEDHGPLFIDWMQLTGPQNEVVNRMFIVYLADKIYDNFYQDMKGRVQFTSNDIRSGEASINITDARLSDAGTYQCGVSHAFGTAKGTIQLTVVG

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0