CEA-related cell adhesion molecule 1, isoform 1/2S

Entry of glycoprotein extracted from GlycoProtDB


Summary
CEA-related cell adhesion molecule 1, isoform 1/2S
  • GlycoProtDB: GPDB0004127
  • UniProt ID: Q3LFS8
  • Gene Symbol: Ceacam1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 71 17406563
22823882
2 89 17406563
22823882
23002422
3 104 22823882
23002422
4 153 17406563
22823882
23002422
5 195 17406563
22823882
23002422

Sequence

MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHQPVTQPFLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGSGSF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0