Allergin-1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Allergin-1
  • GlycoProtDB: GPDB0004169
  • UniProt ID: Q3TB92
  • Gene Symbol: Milr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 68 22823882
23002422
2 113 23002422
3 123 23002422
4 135 23002422

Sequence

MGDGDSPMCLSAVSFKGIRCWLDKLLLWALTISITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLSLLLPGLLLGILVIVLVLAYLIHLKYKKGKKTQREDQSKGSGDAPAQDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGTDGKADYIYSELTH

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0