Amiloride-sensitive sodium channel subunit beta

Entry of glycoprotein extracted from GlycoProtDB


Summary
Amiloride-sensitive sodium channel subunit beta
  • GlycoProtDB: GPDB0004315
  • UniProt ID: Q3TP51
  • Gene Symbol: Scnn1b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 135 22823882
2 172 22823882
3 197 22823882
4 362 22823882

Sequence

MPVKKYLLKCLHRLQKGPGYTYKELLVWYCNNTNTHGPKRIICEGPKKKAMWFLLTLLFACLVCWQWGVFIQTYLSWEVSVSLSMGFKTMNFPAVTVCNSSPFQYSKVKHLLKDLDELMEAVLEKILAPEASHSNTTRTLNFTIWNHTPLVLIDERNPDHPVVLNLFGDSHNSSNPAPGSTCNAQGCKVAMRLCSANGTVCTLRNFTSATQAVTEWYILQATNIFSQVLPQDLVGMGYAPDRIILACLFGTEPCSHRNFTPIFYPDYGNCYIFNWGMTEETLPSANPGTEFGLKLILDIGQEDYVPFLASTAGARLMLHEQRTYPFIREEGIYAMAGTETSIGVLVDKLQRKGEPYSPCTMNGSDVAIKNLYSVYNTTYSIQACLHSCFQDHMIRNCSCGHYLYPLPEGEKYCNNRDFPDWAYCYLNLQMSVTQRETCLSMCKESCNDTQYKMTISMADWPSEASEDWILHVLSQERDQSSNITLSRPGLNLPTAENSSDWR

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0