Cathepsin C, isoform CRA_a

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cathepsin C, isoform CRA_a
  • GlycoProtDB: GPDB0004631
  • UniProt ID: Q3U7T5
  • Gene Symbol: Ctsc
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 53 22823882

Sequence

MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKDVTDFISQLFMQLGTVGMYDLPHLRNKLVIK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0